ADRB2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2048S
Article Name: ADRB2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2048S
Supplier Catalog Number: CNA2048S
Alternative Catalog Number: MBL-CNA2048S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 310 to the C-terminus of human ADRB2 (NP_000015.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 46kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: LLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTNDSLL
Target: A synthetic peptide corresponding to a sequence within amino acids 310 to the C-terminus of human ADRB2 (NP_000015.1).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200