SLFN11 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA20490P
Article Name: SLFN11 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA20490P
Supplier Catalog Number: CNA20490P
Alternative Catalog Number: MBL-CNA20490P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 132-328 of human SLFN11 (NP_689483.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 103kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: LYRRSETSVRSMDSREAFCFLKTKRKPKILEEGPFHKIHKGVYQELPNSDPADPNSDPADLIFQKDYLEYGEILPFPESQLVEFKQFSTKHFQEYVKRTIPEYVPAFANTGGGYLFIGVDDKSREVLGCAKENVDPDSLRRKIEQAIYKLPCVHFCQPQRPITFTLKIVNVLKRGELYGYACMIRVNPFCCAVFSEA
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 132-328 of human SLFN11 (NP_689483.3).
Application Dilute: WB: WB,1:500 - 1:1000