KLK3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2052S
Article Name: KLK3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2052S
Supplier Catalog Number: CNA2052S
Alternative Catalog Number: MBL-CNA2052S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-261 of human KLK3 (NP_001639.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 29kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: ECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 30-261 of human KLK3 (NP_001639.1).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:1000 - 1:5000