CD68 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA20555P
Article Name: CD68 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA20555P
Supplier Catalog Number: CNA20555P
Alternative Catalog Number: MBL-CNA20555P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of mouse CD68 (NP_001277987.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 35kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: SHRPTTTSHGNVTVHTSSGPTTVTHNPATTTSHGNATISHATVSPTTNGTATSPRSSTVGPHPGPPPPSPSPRSKGALGNYTWANGSQPCVQLQAQIQIRI
Target: A synthetic peptide corresponding to a sequence within amino acids 50-150 of mouse CD68 (NP_001277987.1).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200