SARM1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA20556P
| Article Name: |
SARM1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA20556P |
| Supplier Catalog Number: |
CNA20556P |
| Alternative Catalog Number: |
MBL-CNA20556P |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IP, WB |
| Species Reactivity: |
Human |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 625-724 of human SARM1 (NP_055892.2). |
| Conjugation: |
Unconjugated |
| Clonality: |
Polyclonal |
| Molecular Weight: |
79kDa |
| Buffer: |
PBS with 0.05% proclin300,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.05% proclin300,50% glycerol |
| Sequence: |
ALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGRSSRDSSAGSDTSLEGAAPMGPT |
| Target: |
A synthetic peptide corresponding to a sequence within amino acids 625-724 of human SARM1 (NP_055892.2). |
| Application Dilute: |
WB: WB,1:500 - 1:1000|IP,1:500 - 1:1000 |
