SARS-CoV Spike RBD Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA20606P
| Article Name: |
SARS-CoV Spike RBD Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA20606P |
| Supplier Catalog Number: |
CNA20606P |
| Alternative Catalog Number: |
MBL-CNA20606P |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Virus |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 350-450 of coronavirus Spike RBD (NP_828851.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
sars-cov |
| Clonality: |
Polyclonal |
| Molecular Weight: |
139kDa |
| Buffer: |
PBS with 0.05% proclin300,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.05% proclin300,50% glycerol |
| Sequence: |
ADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRP |
| Target: |
A synthetic peptide corresponding to a sequence within amino acids 350-450 of coronavirus Spike RBD (NP_828851.1). |
| Application Dilute: |
WB: WB,1:500 - 1:1000 |
