HCoV-HKU1 Spike S2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA20614P
Article Name: |
HCoV-HKU1 Spike S2 Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA20614P |
Supplier Catalog Number: |
CNA20614P |
Alternative Catalog Number: |
MBL-CNA20614P |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Virus |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 800-900 of coronavirus Spike S2 (YP_173238.1). |
Conjugation: |
Unconjugated |
Clonality: |
Polyclonal |
Molecular Weight: |
152kDa |
Buffer: |
PBS with 0.05% proclin300,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.05% proclin300,50% glycerol |
Sequence: |
IVGQEEFIQTNSPKVTIDCSLFVCSNYAACHDLLSEYGTFCDNINSILDEVNGLLDTTQLHVADTLMQGVTLSSNLNTNLHFDVDNINFKSLVGCLGPHCG |
Target: |
A synthetic peptide corresponding to a sequence within amino acids 800-900 of coronavirus Spike S2 (YP_173238.1). |
Application Dilute: |
WB: WB,1:500 - 1:1000 |