E2F1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2067P
Article Name: E2F1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2067P
Supplier Catalog Number: CNA2067P
Alternative Catalog Number: MBL-CNA2067P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 200-301 of human E2F1 (NP_005216.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 47kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: GGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDSQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPEE
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 200-301 of human E2F1 (NP_005216.1).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:20 - 1:100