HER2/ErbB2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA2071S
| Article Name: |
HER2/ErbB2 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA2071S |
| Supplier Catalog Number: |
CNA2071S |
| Alternative Catalog Number: |
MBL-CNA2071S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC-P, WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1160 to the C-terminus of human HER2/ErbB2 (NP_004439.2). |
| Conjugation: |
Unconjugated |
| Clonality: |
Polyclonal |
| Molecular Weight: |
138kDa |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
ARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV |
| Target: |
A synthetic peptide corresponding to a sequence within amino acids 1160 to the C-terminus of human HER2/ErbB2 (NP_004439.2). |
| Application Dilute: |
WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200 |
