FANCD2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2072T
Article Name: FANCD2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2072T
Supplier Catalog Number: CNA2072T
Alternative Catalog Number: MBL-CNA2072T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 540-720 of FANCD2 (NP_001018125.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 164kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: AFSKQNEASSHIQDDMHLVIRKQLSSTVFKYKLIGIIGAVTMAGIMAADRSESPSLTQERANLSDEQCTQVTSLLQLVHSCSEQSPQASALYYDEFANLIQHEKLDPKALEWVGHTICNDFQDAFVVDSCVVPEGDFPFPVKALYGLEEYDTQDGIAINLLPLLFSQDFAKDGGPVTSQES
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 540-720 of FANCD2 (NP_001018125.1).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000