MonoMethyl-Histone H3-K9 Rabbit mAb, Clone: [ARC2677], Unconjugated, Monoclonal

Catalog Number: MBL-CNA20734S
Article Name: MonoMethyl-Histone H3-K9 Rabbit mAb, Clone: [ARC2677], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA20734S
Supplier Catalog Number: CNA20734S
Alternative Catalog Number: MBL-CNA20734S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ChIP, DOT, ICC, IF, IHC-P, WB
Species Reactivity: All, Human, Mouse, Rat
Immunogen: A synthetic monomethylated peptide around K9 of human Histone H3 (P68431).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2677]
Molecular Weight: 16kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Target: A synthetic monomethylated peptide around K9 of human Histone H3 (P68431).
Application Dilute: WB: DB,1:500 - 1:1000|WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ChIP,1:50 - 1:200|CUT&Tag, 105 cells /1 µg