Acetyl-Histone H3-K18 Rabbit mAb, Clone: [ARC53056], Unconjugated, Monoclonal

Catalog Number: MBL-CNA20735P
Article Name: Acetyl-Histone H3-K18 Rabbit mAb, Clone: [ARC53056], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA20735P
Supplier Catalog Number: CNA20735P
Alternative Catalog Number: MBL-CNA20735P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ChIP, DOT, IHC-P, WB
Species Reactivity: All, Human, Mouse, Rat
Immunogen: A synthetic acetylated peptide around K18 of human Histone H3 (P68431).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC53056]
Molecular Weight: 15kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Target: A synthetic acetylated peptide around K18 of human Histone H3 (P68431).
Application Dilute: WB: DB,1:10000 - 1:100000|WB,1:2000 - 1:10000|IHC-P,1:100 - 1:500|ChIP,1:50 - 1:200|CUT&Tag, 105 cells /1 µg|ChIP-seq,1:50 - 1:200