USP9X/USP9Y Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA20758P
Article Name: USP9X/USP9Y Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA20758P
Supplier Catalog Number: CNA20758P
Alternative Catalog Number: MBL-CNA20758P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 2456-2555 of human USP9X/USP9Y (NP_004645.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 291kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: YFLERSHSARMTLAKACELCPEEEPDDQDAPDEHEPSPSEDAPLYPHSPASQYQQNNHVHGQPYTGPAAHHLNNPQKTGQRTQENYEGNEEVSSPQMKDQ
Target: A synthetic peptide corresponding to a sequence within amino acids 2456-2555 of human USP9X/USP9Y (NP_004645.2).
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200