CSNK2A2 Rabbit mAb, Clone: [ARC51360], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA20791P
| Article Name: |
CSNK2A2 Rabbit mAb, Clone: [ARC51360], Unconjugated, Monoclonal |
| Biozol Catalog Number: |
MBL-CNA20791P |
| Supplier Catalog Number: |
CNA20791P |
| Alternative Catalog Number: |
MBL-CNA20791P |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IP, WB |
| Species Reactivity: |
Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CSNK2A2 (NP_001887.1). |
| Conjugation: |
Unconjugated |
| Clonality: |
Monoclonal |
| Clone Designation: |
[ARC51360] |
| Molecular Weight: |
41kDa |
| Buffer: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
| Sequence: |
LGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR |
| Target: |
A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CSNK2A2 (NP_001887.1). |
| Application Dilute: |
WB: WB,1:500 - 1:1000|IP,1:50 - 1:200 |
