YKL-40/CHI3L1 Rabbit mAb, Clone: [ARC51312], Unconjugated, Monoclonal

Catalog Number: MBL-CNA20792P
Article Name: YKL-40/CHI3L1 Rabbit mAb, Clone: [ARC51312], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA20792P
Supplier Catalog Number: CNA20792P
Alternative Catalog Number: MBL-CNA20792P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 284-383 of human YKL-40/CHI3L1 (NP_001267.2).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC51312]
Molecular Weight: 43kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: PGRFTKEAGTLAYYEICDFLRGATVHRILGQQVPYATKGNQWVGYDDQESVKSKVQYLKDRQLAGAMVWALDLDDFQGSFCGQDLRFPLTNAIKDALAAT
Target: A synthetic peptide corresponding to a sequence within amino acids 284-383 of human YKL-40/CHI3L1 (NP_001267.2).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200