S100P Rabbit mAb, Clone: [ARC50711], Unconjugated, Monoclonal

Catalog Number: MBL-CNA20795P
Article Name: S100P Rabbit mAb, Clone: [ARC50711], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA20795P
Supplier Catalog Number: CNA20795P
Alternative Catalog Number: MBL-CNA20795P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human S100P (NP_005971.1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC50711]
Molecular Weight: 10kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human S100P (NP_005971.1).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200