[KO Validated] SIRT3 Rabbit mAb, Clone: [ARC51526], Unconjugated, Monoclonal

Catalog Number: MBL-CNA20805P
Article Name: [KO Validated] SIRT3 Rabbit mAb, Clone: [ARC51526], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA20805P
Supplier Catalog Number: CNA20805P
Alternative Catalog Number: MBL-CNA20805P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-399 of human SIRT3 (NP_036371.1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC51526]
Molecular Weight: 44kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: QRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
Target: A synthetic peptide corresponding to a sequence within amino acids 300-399 of human SIRT3 (NP_036371.1).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,1:500 - 1:1000