LDL Receptor (LDLR) Rabbit mAb, Clone: [ARC51372], Unconjugated, Monoclonal

Catalog Number: MBL-CNA20808P
Article Name: LDL Receptor (LDLR) Rabbit mAb, Clone: [ARC51372], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA20808P
Supplier Catalog Number: CNA20808P
Alternative Catalog Number: MBL-CNA20808P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 761-860 of human LDL Receptor (LDLR) (NP_000518.1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC51372]
Molecular Weight: 95kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: TVEIVTMSHQALGDVAGRGNEKKPSSVRALSIVLPIVLLVFLCLGVFLLWKNWRLKNINSINFDNPVYQKTTEDEVHICHNQDGYSYPSRQMVSLEDDVA
Target: A synthetic peptide corresponding to a sequence within amino acids 761-860 of human LDL Receptor (LDLR) (NP_000518.1).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200