TROP-2 Rabbit mAb, Clone: [ARC51513], Unconjugated, Monoclonal

Catalog Number: MBL-CNA20824P
Article Name: TROP-2 Rabbit mAb, Clone: [ARC51513], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA20824P
Supplier Catalog Number: CNA20824P
Alternative Catalog Number: MBL-CNA20824P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 27-274 of human TROP-2 (NP_002344.2).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC51513]
Molecular Weight: 36kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 27-274 of human TROP-2 (NP_002344.2).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:2000 - 1:10000|IF/ICC,1:50 - 1:200