Prdm9 Rabbit mAb, Clone: [ARC51589], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA20832P
Article Name: |
Prdm9 Rabbit mAb, Clone: [ARC51589], Unconjugated, Monoclonal |
Biozol Catalog Number: |
MBL-CNA20832P |
Supplier Catalog Number: |
CNA20832P |
Alternative Catalog Number: |
MBL-CNA20832P |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
IHC-P, WB |
Species Reactivity: |
Human, Mouse, Rat |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 87-370 of mouse Prdm9 (NP_659058.3). |
Conjugation: |
Unconjugated |
Clonality: |
Monoclonal |
Clone Designation: |
[ARC51589] |
Molecular Weight: |
97kDa |
Buffer: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
Sequence: |
DSEDSDEEWTPKQQVSPPWVPFRVKHSKQQKESSRMPFSGESNVKEGSGIENLLNTSGSEHVQKPVSSLEEGNTSGQHSGKKLKLRKKNVEVKMYRLRERKGLAYEEVSEPQDDDYLYCEKCQNFFIDSCPNHGPPLFVKDSMVDRGHPNHSVLSLPPGLRISPSGIPEAGLGVWNEASDLPVGLHFGPYEGQITEDEEAANSGYSWLITKGRNCYEYVDGQDESQANWMRYVNCARDDEEQNLVAFQYHRKIF |
Target: |
Recombinant fusion protein containing a sequence corresponding to amino acids 87-370 of mouse Prdm9 (NP_659058.3). |
Application Dilute: |
WB: WB,1:500 - 1:1000|IHC-P,1:500 - 1:1000 |