SARS-CoV-2 Spike S1 Rabbit mAb, Clone: [ARC51489], Unconjugated, Monoclonal

Catalog Number: MBL-CNA20834P
Article Name: SARS-CoV-2 Spike S1 Rabbit mAb, Clone: [ARC51489], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA20834P
Supplier Catalog Number: CNA20834P
Alternative Catalog Number: MBL-CNA20834P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Virus
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of SARS-CoV-2 Spike S1 (YP_009724390.1).
Conjugation: Unconjugated
Alternative Names: sars-cov-2
Clonality: Monoclonal
Clone Designation: [ARC51489]
Molecular Weight: 141kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: YFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK
Target: A synthetic peptide corresponding to a sequence within amino acids 200-300 of SARS-CoV-2 Spike S1 (YP_009724390.1).
Application Dilute: WB: WB,1:2000 - 1:10000|IF/ICC,1:50 - 1:200