TCF1/TCF7 Rabbit mAb, Clone: [ARC51870], Unconjugated, Monoclonal

Catalog Number: MBL-CNA20835P
Article Name: TCF1/TCF7 Rabbit mAb, Clone: [ARC51870], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA20835P
Supplier Catalog Number: CNA20835P
Alternative Catalog Number: MBL-CNA20835P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human TCF1/TCF7 (NP_003193.2).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC51870]
Molecular Weight: 42kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: ELKSSLVNESEGAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKA
Target: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human TCF1/TCF7 (NP_003193.2).
Application Dilute: WB: WB,1:500 - 1:1000