Annexin A11 Rabbit mAb, Clone: [ARC51481], Unconjugated, Monoclonal

Catalog Number: MBL-CNA20841P
Article Name: Annexin A11 Rabbit mAb, Clone: [ARC51481], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA20841P
Supplier Catalog Number: CNA20841P
Alternative Catalog Number: MBL-CNA20841P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 276-505 of human Annexin A11 (NP_001148.1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC51481]
Molecular Weight: 54kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: FDIYEIKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEEGMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTSGDYRKILLKICGGND
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 276-505 of human Annexin A11 (NP_001148.1).
Application Dilute: WB: WB,1:500 - 1:1000