[KO Validated] SLC25A4/ANT1 Rabbit mAb, Clone: [ARC51442], Unconjugated, Monoclonal

Catalog Number: MBL-CNA20842P
Article Name: [KO Validated] SLC25A4/ANT1 Rabbit mAb, Clone: [ARC51442], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA20842P
Supplier Catalog Number: CNA20842P
Alternative Catalog Number: MBL-CNA20842P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SLC25A4/ANT1 (NP_001142.2).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC51442]
Molecular Weight: 33kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: LGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKG
Target: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SLC25A4/ANT1 (NP_001142.2).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000