AIF1/IBA1 Rabbit mAb, Clone: [ARC51847], Unconjugated, Monoclonal

Catalog Number: MBL-CNA20844P
Article Name: AIF1/IBA1 Rabbit mAb, Clone: [ARC51847], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA20844P
Supplier Catalog Number: CNA20844P
Alternative Catalog Number: MBL-CNA20844P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human AIF1/IBA1 (NP_001614.3).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC51847]
Molecular Weight: 17kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human AIF1/IBA1 (NP_001614.3).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:500 - 1:1000|IF/ICC,1:50 - 1:200