Ret Rabbit mAb, Clone: [ARC51764], Unconjugated, Monoclonal

Catalog Number: MBL-CNA20845P
Article Name: Ret Rabbit mAb, Clone: [ARC51764], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA20845P
Supplier Catalog Number: CNA20845P
Alternative Catalog Number: MBL-CNA20845P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human Ret (NP_066124.1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC51764]
Molecular Weight: 124kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: DISKDLEKMMVKRRDYLDLAASTPSDSLIYDDGLSEEETPLVDCNNAPLPRALPSTWIENKLYGMSDPNWPGESPVPLTRADGTNTGFPRYPNDSVYANWM
Target: A synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human Ret (NP_066124.1).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200