Raptor Rabbit mAb, Clone: [ARC52274], Unconjugated, Monoclonal

Catalog Number: MBL-CNA20984P
Article Name: Raptor Rabbit mAb, Clone: [ARC52274], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA20984P
Supplier Catalog Number: CNA20984P
Alternative Catalog Number: MBL-CNA20984P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 888-1013 of human Raptor (NP_065812.1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC52274]
Molecular Weight: 149kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: LTNDVAKQPVSRDLPSGRPGTTGPAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFCDWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNSRVRRQAQQVIQKGITRL
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 888-1013 of human Raptor (NP_065812.1).
Application Dilute: WB: WB,1:100 - 1:500|IF/ICC,1:500 - 1:1000