[KD Validated] Calreticulin Rabbit mAb, Clone: [ARC51269], Unconjugated, Monoclonal

Catalog Number: MBL-CNA20986P
Article Name: [KD Validated] Calreticulin Rabbit mAb, Clone: [ARC51269], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA20986P
Supplier Catalog Number: CNA20986P
Alternative Catalog Number: MBL-CNA20986P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 18-203 of human Calreticulin (NP_004334.1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC51269]
Molecular Weight: 47kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFL
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 18-203 of human Calreticulin (NP_004334.1).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:500 - 1:1000|IF/ICC,1:50 - 1:200