POLR2A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2107T
Article Name: POLR2A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2107T
Supplier Catalog Number: CNA2107T
Alternative Catalog Number: MBL-CNA2107T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1135-1311 of human POLR2A (NP_000928.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 217kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: KTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHL
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1135-1311 of human POLR2A (NP_000928.1).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000