[KO Validated] BRG1/SMARCA4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2117S
Article Name: [KO Validated] BRG1/SMARCA4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2117S
Supplier Catalog Number: CNA2117S
Alternative Catalog Number: MBL-CNA2117S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 680-770 of human BRG1/SMARCA4 (NP_003063.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 185kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: PTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYN
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 680-770 of human BRG1/SMARCA4 (NP_003063.2).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000