CYP2E1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2160P
Article Name: CYP2E1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2160P
Supplier Catalog Number: CNA2160P
Alternative Catalog Number: MBL-CNA2160P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 234-493 of human CYP2E1 (NP_000764.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 57kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: KVIKNVAEVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGCIPPRYKL
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 234-493 of human CYP2E1 (NP_000764.1).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200