[KO Validated] eIF4E Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2162S
Article Name: [KO Validated] eIF4E Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2162S
Supplier Catalog Number: CNA2162S
Alternative Catalog Number: MBL-CNA2162S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4E (NP_001959.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 25kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEP
Target: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4E (NP_001959.1).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:200|IP,1:50 - 1:100