CD18 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2173P
Article Name: CD18 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2173P
Supplier Catalog Number: CNA2173P
Alternative Catalog Number: MBL-CNA2173P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 23-125 of CD18 (NP_000202.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 85kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGY
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 23-125 of CD18 (NP_000202.3).
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200