DLGAP5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2197S
Article Name: DLGAP5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2197S
Supplier Catalog Number: CNA2197S
Alternative Catalog Number: MBL-CNA2197S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 547-846 of human DLGAP5 (NP_055565.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 95kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: KNVFRKKVVSGIASKPKQDDAGRIAARNRLAAIKNAMRERIRQEECAETAVSVIPKEVDKIVFDAGFFRVESPVKLFSGLSVSSEGPSQRLGTPKSVNKAVSQSRNEMGIPQQTTSPENAGPQNTKSEHVKKTLFLSIPESRSSIEDAQCPGLPDLIEENHVVNKTDLKVDCLSSERMSLPLLAGGVADDINTNKKEGISDVVEGMELNSSITSQDVLMSSPEKNTASQNSILEEGETKISQSELFDNKSLTTE
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 547-846 of human DLGAP5 (NP_055565.3).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200