Integrin-beta1/CD29 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2217P
Article Name: Integrin-beta1/CD29 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2217P
Supplier Catalog Number: CNA2217P
Alternative Catalog Number: MBL-CNA2217P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-728 of human Integrin-beta1/CD29 (NP_002202.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 88kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDA
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-728 of human Integrin-beta1/CD29 (NP_002202.2).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200