PER3 Rabbit mAb, Clone: [ARC1893], Unconjugated, Monoclonal

Catalog Number: MBL-CNA2219S
Article Name: PER3 Rabbit mAb, Clone: [ARC1893], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA2219S
Supplier Catalog Number: CNA2219S
Alternative Catalog Number: MBL-CNA2219S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human PER3 (P56645).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1893]
Molecular Weight: 132kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: GRRGAKDEALGEESGERWSPEFHLQRKLADSSHSEQQDRNRVSEELIMVVQEMKKYFPSERRNKPSTLDALNYALRCVHSVQANSEFFQIL
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human PER3 (P56645).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200