KAT2A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2224S
Article Name: KAT2A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2224S
Supplier Catalog Number: CNA2224S
Alternative Catalog Number: MBL-CNA2224S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human KAT2A (NP_066564.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 94kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MAEPSQAPTPAPAAQPRPLQSPAPAPTPTPAPSPASAPIPTPTPAPAPAPAAAPAGSTGTGGPGVGSGGAGSGGDPARPGLSQQQRASQRKAQVRGLPRA
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human KAT2A (NP_066564.2).
Application Dilute: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200|IHC-P,1:50 - 1:200