HDAC9 Rabbit mAb, Clone: [ARC0735], Unconjugated, Monoclonal

Catalog Number: MBL-CNA2226S
Article Name: HDAC9 Rabbit mAb, Clone: [ARC0735], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA2226S
Supplier Catalog Number: CNA2226S
Alternative Catalog Number: MBL-CNA2226S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC9 (Q9UKV0).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0735]
Molecular Weight: 111kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MHSMISSVDVKSEVPVGLEPISPLDLRTDLRMMMPVVDPVVREKQLQQELLLIQQQQQIQKQLLIAEFQKQHENLTRQHQAQLQEHIKELLAIKQQQELL
Target: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC9 (Q9UKV0).
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200