Prolyl hydroxylase PHD1 (EGLN2) Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: Prolyl hydroxylase PHD1 (EGLN2) Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: MBL-CNA2252S
• Supplier Catalog Number: CNA2252S
• Alternative Catalog Number: MBL-CNA2252S
• Manufacturer: MBL
• Host: Rabbit
• Category: Antikörper
• Application: IP, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Prolyl hydroxylase PHD1 (Prolyl hydroxylase PHD1 (EGLN2)) (NP_444274.1).
• Conjugation: Unconjugated

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 44kDa
• Buffer: PBS with 0.02% sodium azide,50% glycerol
• Source: Rabbit
• Purity: Affinity purification
• Form: PBS with 0.02% sodium azide,50% glycerol
• Sequence: MSCSCSSGSGEASAGLMEEALPSAPERLALDYIVPCMRYYGICVKDSFLGAALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGC
• Target: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Prolyl hydroxylase PHD1 (Prolyl hydroxylase PHD1 (EGLN2)) (NP_444274.1).

Application Notes

• Application Dilute: WB: WB,1:500 - 1:2000|IP,1:20 - 1:50