alpha-Actin-1 (ACTA1) Rabbit mAb, Clone: [ARC1914], Unconjugated, Monoclonal

Catalog Number: MBL-CNA2280S
Article Name: alpha-Actin-1 (ACTA1) Rabbit mAb, Clone: [ARC1914], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA2280S
Supplier Catalog Number: CNA2280S
Alternative Catalog Number: MBL-CNA2280S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human alpha-Actin-1 (ACTA1) (P68133).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1914]
Molecular Weight: 42kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: ITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILAS
Target: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human alpha-Actin-1 (ACTA1) (P68133).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200