UHRF1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2343S
Article Name: UHRF1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2343S
Supplier Catalog Number: CNA2343S
Alternative Catalog Number: MBL-CNA2343S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human UHRF1 (NP_001041666.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 90kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFDYEVRLNDTIQLLVRQSLVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSRPADEDMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARE
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human UHRF1 (NP_001041666.1).
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:20 - 1:50