Histone H3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2348P
Article Name: Histone H3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2348P
Supplier Catalog Number: CNA2348P
Alternative Catalog Number: MBL-CNA2348P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ChIP, ICC, IF, IHC-P, IP, WB
Species Reactivity: All, Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human HIST3H3 (NP_003484.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 16kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: REIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA
Target: A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human HIST3H3 (NP_003484.1).
Application Dilute: WB: WB,1:2000 - 1:10000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:300 - 1:700|ChIP,1:200 - 1:400