TGF beta induced (TGFBI) Rabbit mAb, Clone: [ARC0757], Unconjugated, Monoclonal

Catalog Number: MBL-CNA2407S
Article Name: TGF beta induced (TGFBI) Rabbit mAb, Clone: [ARC0757], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA2407S
Supplier Catalog Number: CNA2407S
Alternative Catalog Number: MBL-CNA2407S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human TGF beta induced (TGFBI) (Q15582).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0757]
Molecular Weight: 75kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: AVQKVIGTNRKYFTNCKQWYQRKICGKSTVISYECCPGYEKVPGEKGCPAALPLSNLYETLGVVGSTTTQLYTDRTEKLRPEMEGPGSFTIFAPSNEAWAS
Target: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human TGF beta induced (TGFBI) (Q15582).
Application Dilute: WB: WB,1:500 - 1:2000| IHC-P,1:50 - 1:200