REST/NRSF Rabbit mAb, Clone: [ARC0755], Unconjugated, Monoclonal

Catalog Number: MBL-CNA2415S
Article Name: REST/NRSF Rabbit mAb, Clone: [ARC0755], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA2415S
Supplier Catalog Number: CNA2415S
Alternative Catalog Number: MBL-CNA2415S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human REST/NRSF (Q13127).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0755]
Molecular Weight: 122kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: KGEPHGLENMELRSLELSVVEPQPVFEASGAPDIYSSNKDLPPETPGAEDKGKSSKTKPFRCKPCQYEAESEEQFVHHIRVHSAKKFFVEESAEKQAKARE
Target: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human REST/NRSF (Q13127).
Application Dilute: WB: WB,1:500 - 1:1000|IP,1:500 - 1:1000