[KD Validated] ISG15 Rabbit mAb, Clone: [ARC53794], Unconjugated, Monoclonal

Catalog Number: MBL-CNA2416P
Article Name: [KD Validated] ISG15 Rabbit mAb, Clone: [ARC53794], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA2416P
Supplier Catalog Number: CNA2416P
Alternative Catalog Number: MBL-CNA2416P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human ISG15 (NP_005092.1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC53794]
Molecular Weight: 18kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human ISG15 (NP_005092.1).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200