Glycogen synthase 1 (GYS1) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2519S
Article Name: Glycogen synthase 1 (GYS1) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2519S
Supplier Catalog Number: CNA2519S
Alternative Catalog Number: MBL-CNA2519S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 488-737 of human Glycogen synthase 1 (Glycogen synthase 1 (GYS1)) (NP_002094.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 84kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: LLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALSKAFPEHFTYEPNEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLSTPSEPLSPTSSLGEERN
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 488-737 of human Glycogen synthase 1 (Glycogen synthase 1 (GYS1)) (NP_002094.2).
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:100