CYP3A4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2544S
Article Name: CYP3A4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2544S
Supplier Catalog Number: CNA2544S
Alternative Catalog Number: MBL-CNA2544S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 244-503 of human CYP3A4 (NP_059488.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 57kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: EVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRD
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 244-503 of human CYP3A4 (NP_059488.2).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:20 - 1:50|IF/ICC,1:50 - 1:100