MMP14/MT1-MMP Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2549P
Article Name: MMP14/MT1-MMP Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2549P
Supplier Catalog Number: CNA2549P
Alternative Catalog Number: MBL-CNA2549P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MMP14/MMP14/MT1-MMP (NP_004986.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 66kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: GAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLA
Target: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MMP14/MMP14/MT1-MMP (NP_004986.1).
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200