DARPP32 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2580T
Article Name: DARPP32 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2580T
Supplier Catalog Number: CNA2580T
Alternative Catalog Number: MBL-CNA2580T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human DARPP32 (NP_115568.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 23kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGY
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human DARPP32 (NP_115568.2).
Application Dilute: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200