ATG4A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2598P
Article Name: ATG4A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2598P
Supplier Catalog Number: CNA2598P
Alternative Catalog Number: MBL-CNA2598P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 210-398 of human ATG4A (NP_443168.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 45kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: SKGTSAYCSAWKPLLLIVPLRLGINQINPVYVDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTFHCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 210-398 of human ATG4A (NP_443168.2).
Application Dilute: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200